PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5705_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 324aa    MW: 35411.5 Da    PI: 7.8734
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5705_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP681.9e-21158204147
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47 
                 +Cqv+gCe dls+ak+yhr+h+vCe hsk+p+++v gle+rfCqqC 
  RrC5705_p2 158 RCQVDGCELDLSSAKDYHRKHRVCENHSKCPKITVGGLERRFCQQCC 204
                 6*********************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-22151203IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.307156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-20157204IPR004333Transcription factor, SBP-box
PfamPF031104.6E-16159203IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDCNMTSSLW DWEHLIMSNP SKTENDKRQP STEWEYEKGE GIESMFPSFT GLNRVSSGST  60
TGFSTNSSSP IFKLASEGSP GDSFSNIDFV QAKTSTAVSV ASAESDLCLK LGKQTYSEDY  120
WGRSNNEVSA VSTKLLAPCV VARKKSKAYG QSSMQVPRCQ VDGCELDLSS AKDYHRKHRV  180
CENHSKCPKI TVGGLERRFC QQCCMRSLNL MRRNEAAVNV FLITMLGVAS HKECFQRGIA  240
MESGFTLSFQ RGRGPEEQLY AGSSRSFSAF QTSGGFSAGR SSSQLPGKGV GEYSGGLHES  300
QDFYSALSLL STSSDSHGTK HNPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-14159203650squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896491e-123AC189649.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS010I09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586426.11e-166PREDICTED: squamosa promoter-binding-like protein 10 isoform X2
SwissprotQ8S9L01e-135SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLA0A0D3CE031e-166A0A0D3CE03_BRAOL; Uncharacterized protein
STRINGBra032823.1-P1e-149(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50041653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-115squamosa promoter binding protein-like 10